PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G341500.1.p
Common NameSTM2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 377aa    MW: 42256.2 Da    PI: 6.7898
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G341500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-093033372155
                        HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        k +yps++++  LA+++gL+++q+ +WF N+R ++
  Aqcoe1G341500.1.p 303 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 337
                        569*****************************885 PP

2ELK37.74.4e-13257278122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK  LlrKYsgyLg+LkqEF+
  Aqcoe1G341500.1.p 257 ELKVKLLRKYSGYLGGLKQEFM 278
                        9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-18119163IPR005540KNOX1
PfamPF037903.5E-20120158IPR005540KNOX1
SMARTSM012561.4E-24169220IPR005541KNOX2
PfamPF037915.3E-21173219IPR005541KNOX2
SMARTSM011881.1E-6257278IPR005539ELK domain
PROSITE profilePS5121310.79257277IPR005539ELK domain
PfamPF037894.9E-9257278IPR005539ELK domain
PROSITE profilePS5007112.714277340IPR001356Homeobox domain
SuperFamilySSF466896.42E-19279354IPR009057Homeodomain-like
SMARTSM003894.0E-12279344IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-27282341IPR009057Homeodomain-like
CDDcd000864.08E-12289341No hitNo description
PfamPF059202.5E-16297336IPR008422Homeobox KN domain
PROSITE patternPS000270315338IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEDGGVGSSS NSYSLMGYGE NVCGSGSGSG SGVSSSMMMK PFMTCASSSS SHHFSSNNQN  60
PNTNNNNNNS SSLMMILNKD NYINNNNNNN NNNQLCYFME NNNTTTNTTT DHHDSDSVSA  120
MRAKIMSHPH YSRLLAAYIN CQKIGAPPEA VLKLEEAYAS GEAMSRGAPK SSLGEDPPLD  180
QFMEAYCEML TKYEQELTKP FKEAMVFMSR IELQLKALTV SSSDTGGYHE VADLNGLSEV  240
YGDANDNYVD PRAEDRELKV KLLRKYSGYL GGLKQEFMKK KKKGKLPKEA RQQLVDWWSR  300
HHKWPYPSES QKLALAESTG LDQKQINNWF INQRKRHWKP SEDLQFAVME GMHPHFYMNM  360
NNITNPFSMD CTPTLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8543360.0KC854336.1 Aquilegia coerulea STM2 (STM2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273805.31e-143PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-122HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLS5MLI10.0S5MLI1_AQUCA; STM2
STRINGVIT_12s0059g01190.t011e-142(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-110KNOX/ELK homeobox transcription factor